DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and sod3a

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001092706.1 Gene:sod3a / 504078 ZFINID:ZDB-GENE-050309-208 Length:213 Species:Danio rerio


Alignment Length:171 Identity:63/171 - (36%)
Similarity:85/171 - (49%) Gaps:22/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 CSAAQTRNMPIQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGLKEGKH---GFHIH 77
            |..:...|:|            :...::.|.|.|.|........|::.|.|..|..:   ..|||
Zfish    46 CEVSPIPNLP------------AGQPKIFGQVLFRQVFPNGTAEVKINLRGFPETDNQVRAIHIH 98

  Fly    78 EKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGII 142
            :.|||:.||::.|.||||..|.|  |:|.    ||:||..... |:|........:.|.|...::
Zfish    99 QYGDLSQGCVTAGPHYNPQDVPH--PNHP----GDMGNFMPKQ-GLIRRFLKLPEVKLFGGQSVL 156

  Fly   143 GRGVVVHELEDDLGLGNHTDSKKTGNAGGRIACGVIGINGP 183
            ||.|||||.|||||:|...:||::||||.|||..||||..|
Zfish   157 GRAVVVHEKEDDLGMGADEESKRSGNAGRRIAGCVIGITKP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 55/138 (40%)
sod3aNP_001092706.1 Sod_Cu 60..192 CDD:278508 55/138 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.