DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and Ccs

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001163108.1 Gene:Ccs / 46035 FlyBaseID:FBgn0010531 Length:264 Species:Drosophila melanogaster


Alignment Length:158 Identity:67/158 - (42%)
Similarity:85/158 - (53%) Gaps:9/158 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QAIAYLIGPVQS--DNTQVKGNVTFTQNDCGQNVHVRVQ--LEGLKEGKHGFHIHEKGDLTNGCI 87
            |:...||....|  |.|.::|.|.||.....:...|.|.  ::||..|.||.||||.||.:.||.
  Fly    72 QSAVALINTTGSVVDKTPIQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGLHIHESGDTSAGCS 136

  Fly    88 SMGAHYNPDKVDHGGP--DHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHE 150
            |:|.||||.:..||.|  ..|.||.|||||:.|:..|.....:.|.|:.:   ..||||.||:..
  Fly   137 SVGEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFVDPVLEV---WDIIGRAVVLTA 198

  Fly   151 LEDDLGLGNHTDSKKTGNAGGRIACGVI 178
            ..||||.|.:..|...||:|.|||||:|
  Fly   199 NADDLGRGGNDQSLIDGNSGERIACGII 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 60/139 (43%)
CcsNP_001163108.1 PLN02957 1..253 CDD:215516 67/158 (42%)
HMA 5..64 CDD:238219
Cu-Zn_Superoxide_Dismutase 72..223 CDD:238186 63/153 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466840
Domainoid 1 1.000 57 1.000 Domainoid score I612
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I436
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D608177at33208
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
77.000

Return to query results.
Submit another query.