DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and Sod1

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_476735.1 Gene:Sod1 / 39251 FlyBaseID:FBgn0003462 Length:153 Species:Drosophila melanogaster


Alignment Length:157 Identity:80/157 - (50%)
Similarity:93/157 - (59%) Gaps:7/157 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MPIQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGLKEGKHGFHIHEKGDLTNGCIS 88
            |.::|:..:       |...||.|.|.|...|..|.|..::.||.:|.||||:||.||.||||:|
  Fly     1 MVVKAVCVI-------NGDAKGTVFFEQESSGTPVKVSGEVCGLAKGLHGFHVHEFGDNTNGCMS 58

  Fly    89 MGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELED 153
            .|.|:||...:||.|..|.||:|||||:||.......|..||..|||.|...||||.||||...|
  Fly    59 SGPHFNPYGKEHGAPVDENRHLGDLGNIEATGDCPTKVNITDSKITLFGADSIIGRTVVVHADAD 123

  Fly   154 DLGLGNHTDSKKTGNAGGRIACGVIGI 180
            |||.|.|..||.|||||.||.||||||
  Fly   124 DLGQGGHELSKSTGNAGARIGCGVIGI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 73/135 (54%)
Sod1NP_476735.1 Cu-Zn_Superoxide_Dismutase 2..150 CDD:412632 77/154 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466839
Domainoid 1 1.000 57 1.000 Domainoid score I612
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I436
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D117128at33392
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - P PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1078
1110.860

Return to query results.
Submit another query.