DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and sod1

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_571369.1 Gene:sod1 / 30553 ZFINID:ZDB-GENE-990415-258 Length:154 Species:Danio rerio


Alignment Length:139 Identity:76/139 - (54%)
Similarity:97/139 - (69%) Gaps:0/139 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QVKGNVTFTQNDCGQNVHVRVQLEGLKEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHE 106
            :|.|.|.|.|....:.|.|..::.||..||||||:|..||.||||||.|.|:||....||||...
Zfish    14 EVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDKTHGGPTDS 78

  Fly   107 VRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTGNAGG 171
            |||||||||:.|:::|:..:...|.::||:|:..||||.:|:||.|||||.|.:.:|.|||||||
Zfish    79 VRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGNAGG 143

  Fly   172 RIACGVIGI 180
            |:|||||||
Zfish   144 RLACGVIGI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 72/135 (53%)
sod1NP_571369.1 Cu-Zn_Superoxide_Dismutase 4..147 CDD:238186 69/132 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - LDO PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.830

Return to query results.
Submit another query.