DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and sod1

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_593163.1 Gene:sod1 / 2542128 PomBaseID:SPAC821.10c Length:154 Species:Schizosaccharomyces pombe


Alignment Length:156 Identity:81/156 - (51%)
Similarity:99/156 - (63%) Gaps:6/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGL-KEGKHGFHIHEKGDLTNGCISM 89
            ::|:|.|.|     :::|.|.|||.|.|....|.|.|.|.|. ...|.|||||:.||.||||.|.
pombe     2 VRAVAVLRG-----DSKVSGVVTFEQVDQNSQVSVIVDLVGNDANAKRGFHIHQFGDNTNGCTSA 61

  Fly    90 GAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDD 154
            |.|:||:...||.....|||||||||||:::.|.|..|::|.||:|.|...||||.:|:|..|||
pombe    62 GPHFNPEGKTHGDRTAAVRHVGDLGNLESDAQGNIKTTFSDSVISLFGANSIIGRTIVIHAGEDD 126

  Fly   155 LGLGNHTDSKKTGNAGGRIACGVIGI 180
            ||.|...:|.||||||.|.|||||||
pombe   127 LGKGTSEESLKTGNAGARNACGVIGI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 73/136 (54%)
sod1NP_593163.1 Sod_Cu 13..150 CDD:278508 73/136 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61834
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - LDO PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1078
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.