DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and Sod3

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_037012.1 Gene:Sod3 / 25352 RGDID:3733 Length:244 Species:Rattus norvegicus


Alignment Length:152 Identity:58/152 - (38%)
Similarity:71/152 - (46%) Gaps:25/152 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DNTQVKGNVTFTQNDCGQNVHVRVQLEGL----KEGKHGFHIHEKGDLTNGCISMGAHYNPDKVD 99
            |..|:.|.|.|.|......:.....|||.    ....|..|:||.|||:.||.|.|.||||..|.
  Rat    81 DQPQITGLVLFRQLGPSSRLEASFNLEGFPAEQNTSNHAIHVHEFGDLSQGCESTGPHYNPLGVP 145

  Fly   100 HGGPDHEVRHVGDLGN-------LEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGL 157
            |      .:|.||.||       |..:..|:        ..:|.|...|:||.||||..|||||.
  Rat   146 H------PQHPGDFGNFVVRDGRLWKHRMGL--------ATSLAGPHSILGRAVVVHAGEDDLGK 196

  Fly   158 GNHTDSKKTGNAGGRIACGVIG 179
            |.:..|.:.||||.|:||.|:|
  Rat   197 GGNQASVQNGNAGRRLACCVVG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 55/146 (38%)
Sod3NP_037012.1 Sod_Cu 84..217 CDD:278508 53/143 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 224..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.