DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and Sod1

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_058746.1 Gene:Sod1 / 24786 RGDID:3731 Length:154 Species:Rattus norvegicus


Alignment Length:159 Identity:81/159 - (50%)
Similarity:105/159 - (66%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 MPIQAIAYL--IGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGLKEGKHGFHIHEKGDLTNGC 86
            |.::|:..|  .||||       |.:.|.|...|:.|.|..|:.||.||:||||:|:.||.|.||
  Rat     1 MAMKAVCVLKGDGPVQ-------GVIHFEQKASGEPVVVSGQITGLTEGEHGFHVHQYGDNTQGC 58

  Fly    87 ISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHEL 151
            .:.|.|:||....||||..|.||||||||:.|...|:.:|:..|:||:|:|:..||||.:||||.
  Rat    59 TTAGPHFNPHSKKHGGPADEERHVGDLGNVAAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEK 123

  Fly   152 EDDLGLGNHTDSKKTGNAGGRIACGVIGI 180
            :||||.|.:.:|.||||||.|:|||||||
  Rat   124 QDDLGKGGNEESTKTGNAGSRLACGVIGI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 70/135 (52%)
Sod1NP_058746.1 Cu-Zn_Superoxide_Dismutase 3..147 CDD:238186 73/150 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - LDO PTHR10003
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.