DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and sod-4

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001255002.1 Gene:sod-4 / 176336 WormBaseID:WBGene00004933 Length:221 Species:Caenorhabditis elegans


Alignment Length:219 Identity:91/219 - (41%)
Similarity:127/219 - (57%) Gaps:26/219 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MMQYLVVSLALCATICSAAQTRNMPIQAIAYLI----GPVQSDNTQVKGNVTFTQNDCGQNVHVR 61
            |...:|:.|||...|.:|::.    |:|.||:.    |.:.   |::.|.:.|.|:  |..:.:.
 Worm     1 MKTRVVLILALSVCIEAASEV----IRARAYIFKAEAGKIP---TELIGTIDFDQS--GSFLKLN 56

  Fly    62 VQLEGLKEGKHGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDV 126
            ..:.||..||||||||||||..|||:|.|.||||.|:.||.||...||:|||||:|:.::|...:
 Worm    57 GSVSGLAAGKHGFHIHEKGDTGNGCLSAGGHYNPHKLSHGAPDDSNRHIGDLGNIESPASGDTLI 121

  Fly   127 TYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHTDSKKTGNAGGRIACGVIGINGPSV----PA 187
            :.:|.:.:|:|:..||||.||:||..||||.|....||.|||||.|:|||.|||....:    .|
 Worm   122 SVSDSLASLSGQYSIIGRSVVIHEKTDDLGRGTSDQSKTTGNAGSRLACGTIGIVEERILETTTA 186

  Fly   188 PAPPTPRHQPL---------YYVP 202
            ..||..:.||:         :|:|
 Worm   187 SLPPVTQSQPIGSSSYYYSTFYLP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 68/135 (50%)
sod-4NP_001255002.1 Cu-Zn_Superoxide_Dismutase 41..170 CDD:238186 65/130 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H70665
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 1 1.000 - - oto18199
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16961
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.