DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and sod-1

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001021956.1 Gene:sod-1 / 174141 WormBaseID:WBGene00004930 Length:180 Species:Caenorhabditis elegans


Alignment Length:180 Identity:79/180 - (43%)
Similarity:106/180 - (58%) Gaps:12/180 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VSLALCATICSAAQTRNMPIQAIAYLIGPVQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGLKEGK 71
            ||.|:...:.:|.:..|   :|:|.|.|..      |.|.:..||........:..:::||..|.
 Worm     9 VSNAIFPQVEAAQKMSN---RAVAVLRGET------VTGTIWITQKSENDQAVIEGEIKGLTPGL 64

  Fly    72 HGFHIHEKGDLTNGCISMGAHYNPDKVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLT 136
            ||||:|:.||.||||||.|.|:||....||||..|:||||||||:||.:.|:..:..||.::||.
 Worm    65 HGFHVHQYGDSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTDTLVTLY 129

  Fly   137 GKLGIIGRGVVVHELEDDLGLG---NHTDSKKTGNAGGRIACGVIGINGP 183
            |...::||.:|||..:||||.|   ...:||||||||.|.|||||.:..|
 Worm   130 GPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAACGVIALAAP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 67/138 (49%)
sod-1NP_001021956.1 Cu-Zn_Superoxide_Dismutase 26..171 CDD:238186 68/150 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S341
OMA 1 1.010 - - QHG61834
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 1 1.000 - - FOG0000641
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101013
Panther 1 1.100 - - LDO PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1078
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.