DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sod3 and sod3

DIOPT Version :9

Sequence 1:NP_001033939.2 Gene:Sod3 / 36232 FlyBaseID:FBgn0033631 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001106630.1 Gene:sod3 / 100127868 XenbaseID:XB-GENE-1008938 Length:239 Species:Xenopus tropicalis


Alignment Length:213 Identity:71/213 - (33%)
Similarity:93/213 - (43%) Gaps:45/213 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YLVVSLALCATICSAAQTRNMPIQ---------------------------AIAYL---IGP--- 35
            ||.|:|.:|..:.:.|:... |::                           .|||.   :.|   
 Frog     6 YLAVALTVCELLSAGAEVVK-PVEEELLTDTNKKVNELWINLLNMKPTDNDGIAYATCSLSPSSK 69

  Fly    36 VQSDNTQVKGNVTFTQNDCGQNVHVRVQLEGL----KEGKHGFHIHEKGDLTNGCISMGAHYNPD 96
            ::....:|.|.|.|.|......:.....|||.    .:.....|||..|||||||.|.|.||||.
 Frog    70 LEPSEVKVTGLVLFKQVFPSGTLEAIFDLEGFPTDANQSARAIHIHTYGDLTNGCDSAGGHYNPM 134

  Fly    97 KVDHGGPDHEVRHVGDLGNLEANSTGIIDVTYTDQVITLTGKLGIIGRGVVVHELEDDLGLGNHT 161
            .|||      .:|.||.||..... |.|...:.:...||.|...:|||.||||:..||||.||:.
 Frog   135 SVDH------PQHPGDFGNFRVRD-GKIQKFFANLDATLFGPFSVIGRSVVVHKQADDLGKGNNQ 192

  Fly   162 DSKKTGNAGGRIACGVIG 179
            .|.:.||||.|:||.:||
 Frog   193 ASLENGNAGKRLACCIIG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sod3NP_001033939.2 Sod_Cu 42..178 CDD:278508 58/139 (42%)
sod3NP_001106630.1 Sod_Cu 76..209 CDD:376292 58/139 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1574423at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.