DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and cd63l

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001037906.1 Gene:cd63l / 733515 XenbaseID:XB-GENE-22164536 Length:244 Species:Xenopus tropicalis


Alignment Length:233 Identity:69/233 - (29%)
Similarity:124/233 - (53%) Gaps:11/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLAPPIVLIVTGLIIFLIASLGCFG 73
            :|..|....:||.::|:.::..||.|...:.:.:..:.......|:||.|||:|||:::..|...
 Frog    13 LKAGLLFIILLFWVTGVALICLGATVQLRLTDISVVLSETSSGAPLVLTVTGIIIFIMSGFGAIS 77

  Fly    74 AIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKR--SNSEDTMAWDNI 136
            .:||:..|:.||..::.||||:|:.|||:|..:::.|:..:....|:.:.:  .:.:.|.:.|..
 Frog    78 VLKENNMLIKTFIGIMVVIFIIEIIVGISAYSYREKLQSDISRRFQQILSKYGIDGQLTRSLDYA 142

  Fly   137 QQKLMCCGVDSPADWRTLSAN---KTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGKLK 198
            ||:..|||..:..||..::..   .::|.|||:     .....|.|.....:|..|..|||.|:|
 Frog   143 QQEFRCCGAQNFTDWMNVTVTLLPSSVPKSCCR-----KVTPKCGEKVMAHQDNIFLEGCVIKMK 202

  Fly   199 DRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQE 236
            ..|.::..::..||:|:.|:|:.||:|: :|...|.||
 Frog   203 TWISQHIDVIGAVGVGLGFVQLFGILLS-FLLVKILQE 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 66/228 (29%)
uroplakin_I_like_LEL 102..205 CDD:239409 26/107 (24%)
cd63lNP_001037906.1 Tetraspannin 13..233 CDD:366035 65/225 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.