DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and tspan36

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001037876.1 Gene:tspan36 / 733459 XenbaseID:XB-GENE-5730963 Length:240 Species:Xenopus tropicalis


Alignment Length:227 Identity:56/227 - (24%)
Similarity:105/227 - (46%) Gaps:12/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGR-VLAPPIVLIVTGLIIFLIASLGCFG 73
            |..|...:::|..:.:|:...|...:....::.:.:... |:.|.::::...:::|:||.|||..
 Frog     9 KTFLLLVSLIFLAASVGLAYVGISTIVTYKQYENLLGNMYVMLPSVIILAIAVVMFVIAILGCCS 73

  Fly    74 AIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSED--TMAWDNI 136
            ..:||...|..|..|:::||...:|..|...||...:...::.::....|..|..|  :...|.|
 Frog    74 TTQESCCGLGCFMFLISIIFAAGVAAMILGLVFVDKINPELEKNMDNLFKTYNGVDVSSSTVDFI 138

  Fly   137 QQKLMCCGVDSPADWRT---LSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGKLK 198
            |::|.|||..:..||..   ...||:||.|||:....|     |.......||.|.: .|..||:
 Frog   139 QERLECCGRKNYTDWEETDWYQTNKSLPMSCCKKNAQD-----CQRVIGQQKDIYTE-ACEPKLE 197

  Fly   199 DRIEKNAIILIGVGIGIAFIQILGIVLACYLA 230
            :.|.:.....:.|.:|.|.:::..::..|.::
 Frog   198 NLIHQVLRYSMFVILGFAIVELFAMISICVIS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 56/227 (25%)
uroplakin_I_like_LEL 102..205 CDD:239409 30/107 (28%)
tspan36NP_001037876.1 Tetraspannin 9..231 CDD:278750 56/227 (25%)
Tmemb_55A <14..72 CDD:286827 10/57 (18%)
tetraspanin_LEL 103..205 CDD:243179 30/107 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.