DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and TSPAN6

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_003261.1 Gene:TSPAN6 / 7105 HGNCID:11858 Length:245 Species:Homo sapiens


Alignment Length:231 Identity:74/231 - (32%)
Similarity:118/231 - (51%) Gaps:18/231 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHF--VEGRVLAPPIVLIVTGLIIFLIASLGCF 72
            |.||..:..:|.|:|:.:|..|  :...|:..|:|  :..:....|.|||.||.:|.|:.:.|||
Human    18 KSVLLIYTFIFWITGVILLAVG--IWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCF 80

  Fly    73 GAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSED---TMAWD 134
            ...:.|..:|..:|:.|.::|:|||...|...||:.:::...||:.::::|:.||..   :.|.|
Human    81 ATCRASAWMLKLYAMFLTLVFLVELVAAIVGFVFRHEIKNSFKNNYEKALKQYNSTGDYRSHAVD 145

  Fly   135 NIQQKLMCCGVDSPADWRTLS--ANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGKL 197
            .||..|.||||....||...:  :.|..|.|||:.:  |.|       |....||....||..|:
Human   146 KIQNTLHCCGVTDYRDWTDTNYYSEKGFPKSCCKLE--DCT-------PQRDADKVNNEGCFIKV 201

  Fly   198 KDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSI 233
            ...||....::.|:..|:|..|::||.||..|:.:|
Human   202 MTIIESEMGVVAGISFGVACFQLIGIFLAYCLSRAI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 73/229 (32%)
uroplakin_I_like_LEL 102..205 CDD:239409 33/107 (31%)
TSPAN6NP_003261.1 Tetraspannin 17..236 CDD:306775 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20700
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8510
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.