DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tspan11

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_081019.1 Gene:Tspan11 / 68498 MGIID:1915748 Length:253 Species:Mus musculus


Alignment Length:242 Identity:74/242 - (30%)
Similarity:121/242 - (50%) Gaps:20/242 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKYVLFAFNVLFAISGLGILIAGAVVLADVNEF-NHFVEGRVLAPPIVLIVTGLIIFLIASLGCF 72
            :||:||.||..|.:.|..::..|...|.:.:.: :........|...:||..|.::.....|| |
Mouse    16 LKYLLFIFNFFFWVGGAAVMAVGIWTLVEKSGYLSILASSTFAASAYILIFVGGLVMTTGFLG-F 79

  Fly    73 GA-IKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESI-----KRSNSEDTM 131
            || |:|..:.|.|:..||.|||:|||..|:.|.|:.:.|...:|..|..::     :...:|.|.
Mouse    80 GAIIREQKSCLSTYFCLLLVIFLVELVAGVLAHVYYQRLSDELKWHLNSTLTEHYGQPRAAEITA 144

  Fly   132 AWDNIQQKLMCCGVDSPADWR----TLS---ANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYF 189
            :.|.:||...|||.:|.|||:    .||   ..:.:|.|||:     :.|..|.:..........
Mouse   145 SVDRLQQDFKCCGSNSSADWQHSAYILSQEALGRQVPDSCCK-----TVVARCGQRAHPSNIYKV 204

  Fly   190 QVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQE 236
            :.||:.||:..:..:.:::..||||:|.:||.|:||.|.|...::|:
Mouse   205 EGGCMAKLEQFVADHLLLMGAVGIGVACLQICGMVLTCCLHRRLQQQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 73/237 (31%)
uroplakin_I_like_LEL 102..205 CDD:239409 29/114 (25%)
Tspan11NP_081019.1 Tetraspannin 16..244 CDD:395265 72/233 (31%)
CD151_like_LEL 112..220 CDD:239408 28/112 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.