DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and tspan11

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_005164709.1 Gene:tspan11 / 564029 ZFINID:ZDB-GENE-041210-93 Length:260 Species:Danio rerio


Alignment Length:248 Identity:69/248 - (27%)
Similarity:125/248 - (50%) Gaps:31/248 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLA-PPIVLIVTGLIIFLIASLGCF 72
            :||:||.||.||.:.|..::..|...|.|..|:...:.....| ...:||:.|.::.:...|||.
Zfish    17 LKYLLFVFNFLFWMGGGVVMGVGIWTLVDKGEYLSLLASSTFAVSAYILILAGGLVMVTGFLGCC 81

  Fly    73 GAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSED-----TMA 132
            ..|:|..:.|.|:...|.:||::||..|:.|.|:.:.|...:|..|.:::..:.::.     |.:
Zfish    82 AVIREQRSCLSTYFSCLLLIFLIELVAGVLAYVYYQALSEELKQHLSKTMMENYAQPGKESITQS 146

  Fly   133 WDNIQQKLMCCGVDSPADW-------RTLSANKTLPGSCCQPQYIDSTVGHCLESPALGK----D 186
            .|.:||...|||.::..||       ...:.::.:|.|||:      |:     :|..|:    .
Zfish   147 VDRLQQDFKCCGSNNSLDWMHSVYIMSQAADSRVVPDSCCK------TI-----TPQCGRRDHPS 200

  Fly   187 KYFQV--GCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVL-ACYLANSIRQE 236
            ..::|  ||:.||:..:..:.:|:..||||:|.:|::|.|| ||::....::|
Zfish   201 NIYKVEGGCITKLEQFLADHLLIIGAVGIGVACLQLIGAVLTACFIYLLYKEE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 68/243 (28%)
uroplakin_I_like_LEL 102..205 CDD:239409 26/120 (22%)
tspan11XP_005164709.1 Tetraspannin 16..246 CDD:278750 68/239 (28%)
Vac7 <85..115 CDD:289517 10/29 (34%)
CD151_like_LEL 113..221 CDD:239408 25/118 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4480
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.990

Return to query results.
Submit another query.