DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and cd151

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_005174294.1 Gene:cd151 / 450020 ZFINID:ZDB-GENE-041010-137 Length:259 Species:Danio rerio


Alignment Length:261 Identity:81/261 - (31%)
Similarity:136/261 - (52%) Gaps:40/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SCGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRV-LAPPIVLIVTGLIIFLI 66
            |||...:||:||.||:||.::|..::..|...|.|.:::...:.... :....:||..|.::...
Zfish    10 SCGTVCLKYLLFVFNLLFWLAGGAVMAVGIWTLLDKSDYISLLSSNTYMVAAFILIGAGAVVVFT 74

  Fly    67 ASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVF-----------KKDLEGMVKNSLQE 120
            ..|||...|:|..:|||.|.:||.:||::|:..|:.|.|:           ..:|...:|..:.|
Zfish    75 GILGCCATIREQRSLLIVFLILLLLIFLLEITAGVLAYVYYQECFPLCYQLNAELRADLKERMVE 139

  Fly   121 SIKRSNSED-TMAWDNIQQKLMCCGVDSPADW------RTLSANKTLPGSCCQPQYIDSTVGHCL 178
            :.::...|. |.|.||:||.|.|||.:|.|||      |..:..:.:|.|||             
Zfish   140 NYQQPGQEHITRAIDNLQQDLKCCGSNSSADWRDGAWIRNYADRRLVPDSCC------------- 191

  Fly   179 ESPALG------KDKYFQV--GCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQ 235
            ::|::|      ....::|  ||:.||::.|.::.:||..||:||||:||:|::..|.|..|:::
Zfish   192 KTPSVGCGVRDHPSNIYKVEGGCISKLEEFILQHLLILGSVGLGIAFVQIVGMIFTCCLYRSLKE 256

  Fly   236 E 236
            |
Zfish   257 E 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 76/250 (30%)
uroplakin_I_like_LEL 102..205 CDD:239409 33/128 (26%)
cd151XP_005174294.1 Tetraspannin 15..254 CDD:278750 76/251 (30%)
CD151_like_LEL 112..226 CDD:239408 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 140 1.000 Inparanoid score I4480
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.890

Return to query results.
Submit another query.