DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and tspan7b

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001124290.1 Gene:tspan7b / 449539 ZFINID:ZDB-GENE-040927-5 Length:249 Species:Danio rerio


Alignment Length:241 Identity:75/241 - (31%)
Similarity:122/241 - (50%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLA--------PPIVLIVTGLIIFLI 66
            |.|:.....|..:......|.||::|| |..:..|:.|..::        .|.|||.||..|.:.
Zfish     9 KPVITCLKTLLIVYSFVFWITGAILLA-VGLWGKFILGPYISLIAENSTNAPYVLIGTGTTIIVF 72

  Fly    67 ASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSED-- 129
            ...|||...:.||.:|..:|:.|:::|:.||..||:..||:.:::|....:..|:::..|::|  
Zfish    73 GLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKGTFLRTYNEAVQNYNAQDER 137

  Fly   130 TMAWDNIQQKLMCCGVDSPADWRT---LSANKTLPGSCCQPQYIDSTVGHC----LESPALGKDK 187
            ::|.||:|:.|.||||.:...|.:   ...| .:|.|||      :.:..|    |.:..:...|
Zfish   138 SIAVDNVQRSLRCCGVLNYTSWFSSVYFPVN-GIPPSCC------ANISDCNASDLRNATIAPTK 195

  Fly   188 YFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSI 233
            .:|.||...:...||.|..|:.||..||||.|::|::|||.|:..|
Zfish   196 VYQQGCYELVTTFIETNMGIIAGVTFGIAFSQLIGMLLACCLSRFI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 74/239 (31%)
uroplakin_I_like_LEL 102..205 CDD:239409 29/111 (26%)
tspan7bNP_001124290.1 Tetraspannin 14..239 CDD:278750 72/232 (31%)
TM4SF2_6_like_LEL 110..213 CDD:239414 29/109 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.770

Return to query results.
Submit another query.