DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and tspan36

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001002748.1 Gene:tspan36 / 437021 ZFINID:ZDB-GENE-040718-248 Length:243 Species:Danio rerio


Alignment Length:235 Identity:65/235 - (27%)
Similarity:115/235 - (48%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGR-VLAPPIVLIVTGLIIFLIA 67
            ||....|.:|...:::|..:|..:...|:.|:...|.|..|:..| .|.|..::|...:::|:|.
Zfish     3 CGIITSKTILLLLSLIFWAAGAALAYVGSYVIKSYNNFEDFMSDRHTLIPAAIIIGVAVVMFIIG 67

  Fly    68 SLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKR---SNSED 129
            .:||...::||...|..|.:::.:||..|:...:...:::..:.|.::.|:.:...:   .||| 
Zfish    68 FVGCCATLRESKVGLGLFLIIIMLIFAAEVTAFVFGIIYRGRIRGDLEKSMNDVFLKYDGLNSE- 131

  Fly   130 TMAWDNIQQKLMCCGVDSPADWRTLSA-----NKTLPGSCCQPQYIDSTVGHCLESPALGKDKYF 189
            |.|.|.:|.:|.||||.:..|| ||::     |.|:|.|||:......| |. |..|.|...:  
Zfish   132 THAVDYLQSQLECCGVKNQTDW-TLTSWFAQHNNTVPQSCCKANMTQCT-GQ-LSQPDLLNTQ-- 191

  Fly   190 QVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYL 229
              ||..||:..::......:.|.:|.|.|:..|::..|.:
Zfish   192 --GCEAKLEQVLQDVLSYAMLVILGFAIIKFFGMLSVCVI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 63/230 (27%)
uroplakin_I_like_LEL 102..205 CDD:239409 33/110 (30%)
tspan36NP_001002748.1 TM4SF8_like_LEL 103..206 CDD:239416 33/110 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.