DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp96F

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001262976.1 Gene:Tsp96F / 43127 FlyBaseID:FBgn0027865 Length:284 Species:Drosophila melanogaster


Alignment Length:268 Identity:69/268 - (25%)
Similarity:122/268 - (45%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLIKYVLFAFNVLFAISGLGILIAGAVVLAD-------VNEFNHFVEGRVLAPPIVLIVTGLIIF 64
            |.:||::...|:||.:.||.|::....:|.|       ...:||:     .....|.:..|::|.
  Fly     8 SCVKYLMVLINILFWLIGLTIVVTSVWMLTDPTFMLSMTQNYNHY-----HIALYVFLAIGILIT 67

  Fly    65 LIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSED 129
            |.|..||.|..:||..||::|..::.::.:.::|.|..|...|..|:.:|:.:::.|::....:.
  Fly    68 LGAFFGCCGVCRESQCLLVSFFCVILIVMVAQIAAGAWAFHNKDKLDDIVRAAVKSSVQEEYGQS 132

  Fly   130 TMA-----WDNIQQKLMCCGVDSPADWRTLSANK------------------TLPGSCCQPQYID 171
            ||:     :|.:|:.|.|||.|.|.||.|...|.                  .:|.|||:....|
  Fly   133 TMSSRTVTFDTLQKNLKCCGADGPGDWATSRFNNVDRTNIVEIAVSSMNVFYNIPESCCKDNLKD 197

  Fly   172 STVGHCLESPALG-----KDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLAN 231
            :   .|..|..|.     .:..:|.|||.||.:.|.:|.:.:..|...:..:::|.:..|..|..
  Fly   198 N---ECELSRRLKFGGPLNNAIYQQGCVDKLIEIIYENWVTIFAVTAAVILLELLSLTFALSLCC 259

  Fly   232 SIRQERAK 239
            ::|.:..|
  Fly   260 AVRNQHYK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 66/258 (26%)
uroplakin_I_like_LEL 102..205 CDD:239409 34/130 (26%)
Tsp96FNP_001262976.1 Tetraspannin 9..261 CDD:278750 66/259 (25%)
CD151_like_LEL 107..233 CDD:239408 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.