DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp86D

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001262468.1 Gene:Tsp86D / 41310 FlyBaseID:FBgn0037848 Length:316 Species:Drosophila melanogaster


Alignment Length:269 Identity:71/269 - (26%)
Similarity:129/269 - (47%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLIKYVLFAFNVLFAISGLGILIAGAVV-----LADVNEFNHF--VEGRVLAPPIVLIVTGLIIF 64
            |.:||::|..|.||.:.| |:|:|..|.     |.|.|.:...  :...:....:|:|:.|:|:|
  Fly    29 SCVKYMIFLLNFLFWLFG-GLLLAIGVYAFMDKLMDGNGWLRLDTIYDVIFNISLVMIIAGVIVF 92

  Fly    65 LIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSED 129
            .::..||.||::|:..||..:::.|.:.||:|:::.|...||.:.:...::....:.|..|..:|
  Fly    93 TVSFAGCLGALRENTWLLKLYSMCLLLFFILEMSLAIICFVFPQYMNSFLEYQFTDKIIHSYRDD 157

  Fly   130 TMAW---DNIQQKLMCCGVDSPA--DWRTLSANK------------TLPGSCCQPQYIDST---- 173
            :...   |..||:..|||:.:..  ||   |.|:            .:|.|||    |::|    
  Fly   158 SDLQNFIDFAQQEFNCCGLSNAGYQDW---SKNEYFNCSSPSVERCGVPYSCC----INATDISS 215

  Fly   174 --------VGHCLESPALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLA 230
                    .|..:.|.|....:.:..||:..::..:|:|..::.||.:|||.:|:..|.||..|.
  Fly   216 GLVNIMCGYGVQVRSVAAASKRIWTSGCIEIVRVWVERNLYVIAGVALGIALLQLFVIYLAKTLE 280

  Fly   231 NSIRQERAK 239
            ..|..::::
  Fly   281 GQIDLQKSR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 69/259 (27%)
uroplakin_I_like_LEL 102..205 CDD:239409 27/131 (21%)
Tsp86DNP_001262468.1 Tetraspannin 51..283 CDD:278750 60/238 (25%)
penumbra_like_LEL 132..255 CDD:239411 27/129 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442892
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.