DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and tspan7

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_999939.1 Gene:tspan7 / 406802 ZFINID:ZDB-GENE-030131-5435 Length:251 Species:Danio rerio


Alignment Length:238 Identity:74/238 - (31%)
Similarity:121/238 - (50%) Gaps:24/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKYVLFAFNVLFAISGLGILIAGAVVLADVN-EFNHFVEG-RVLAPPIVLIVTGLIIFLIASLGC 71
            :|..|.:::::|..:|:.:|..|  |...|| ||:..|.. .....|.|||.||.:|.:....||
Zfish    17 LKTFLISYSLIFWFTGVILLAVG--VWGKVNLEFDLLVNSEHGTNAPYVLIGTGAVIIIFGLFGC 79

  Fly    72 FGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSEDTMAWDNI 136
            |...:.||.:|..:|:.|.::|:.||..||:..:|:.:::.::|.:.|::......:|....|.|
Zfish    80 FATCRGSPWMLKLYAMFLVLVFLAELVAGISGFIFRHEIKAVLKGAYQKAESNYMGKDDEDLDRI 144

  Fly   137 QQKLMCCGVDSPADWRTLSANKT------LPGSCCQPQYIDSTVGHCLESPALGKDK-----YFQ 190
            |:.|.|||.::...|    ||.|      :|.|||.   :.::| :|..:......|     |.|
Zfish   145 QRTLQCCGEENYTSW----ANTTYFEKEGIPKSCCN---VTASV-NCTSAELKDLKKADSVVYHQ 201

  Fly   191 VGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSI 233
             ||...:...:|.|..|:.|:..||||.|::||.|||.|:..|
Zfish   202 -GCFSLMSTTMEANLGIIAGISFGIAFFQVIGIFLACCLSRYI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 73/236 (31%)
uroplakin_I_like_LEL 102..205 CDD:239409 27/113 (24%)
tspan7NP_999939.1 Tetraspannin 16..243 CDD:278750 73/236 (31%)
TM4SF2_6_like_LEL 112..215 CDD:239414 27/111 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20700
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.