DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp42Eq

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_523643.2 Gene:Tsp42Eq / 35628 FlyBaseID:FBgn0033138 Length:219 Species:Drosophila melanogaster


Alignment Length:241 Identity:62/241 - (25%)
Similarity:107/241 - (44%) Gaps:35/241 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SCGPSLIKYVLFAFNVLFAI-SGLGILIAGAVVLADVNEFNHFVEGRVLAPPIVLIVTGLIIFLI 66
            |||...:|...|..:.|..: :.|.|......::|    |:|.|..||  |.|:.||.|.::|..
  Fly     2 SCGTKALKVSSFVLDFLCCVLAALTIAACSYALIA----FSHSVAIRV--PSILGIVLGGLLFFS 60

  Fly    67 ASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIK-RSNSEDT 130
            ...||..|::||..:...:|.:|..:...::.|.:|..:   :.|.:...::.::.: :....|.
  Fly    61 TIFGCIAALRESIRMTWIYAAILLALVFSQITVILAQPI---NYELLANETIYDAWQGQLYHSDR 122

  Fly   131 MAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVG 195
            |::..|  |..|||...||::.  .:...:|.||    |.:       ::..:..|.| .|||..
  Fly   123 MSYFEI--KYHCCGQTGPANYP--DSGLVIPQSC----YFN-------QNATVTTDLY-TVGCNH 171

  Fly   196 KLK------DRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQ 235
            :|.      .|.||.....: ||:.|..:.|.|: ||..|.|:.|:
  Fly   172 QLAAAFVKGTRWEKITDWSV-VGVEILTVIIAGL-LAITLQNAERR 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 58/231 (25%)
uroplakin_I_like_LEL 102..205 CDD:239409 24/109 (22%)
Tsp42EqNP_523643.2 Tetraspannin 8..209 CDD:278750 56/227 (25%)
tetraspanin_LEL 95..173 CDD:239401 20/96 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.