DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp42Ej

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_523636.1 Gene:Tsp42Ej / 35620 FlyBaseID:FBgn0033132 Length:227 Species:Drosophila melanogaster


Alignment Length:187 Identity:36/187 - (19%)
Similarity:76/187 - (40%) Gaps:28/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKR 124
            |..:|.:|.||.:.|:|.|....|.:.:...::.....:.....:..::.|.|..:..:::..:|
  Fly    52 GGAVFGVAFLGMYVALKVSYKYSIYYLICSGLVIAALGSYLFTFTAMREQLMGRFEERMRDLFER 116

  Fly   125 -SNSEDTMAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCC------QPQYIDSTVGHCLESPA 182
             ::|:|.|  ..:.....|||::.|.|: ....:..||.|||      :|.::            
  Fly   117 KTHSDDKM--QPVHSLFGCCGIEGPQDY-LQEEHGALPSSCCYAFDCSKPAHV------------ 166

  Fly   183 LGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQERAK 239
                  ::.||..|....:...|.:.....:.|..::.||:..|.:|..:.:..:.|
  Fly   167 ------YEEGCSTKAVATLRMQAELNYYSCMAIIALEFLGLFTAYHLGKARKYAKTK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 35/179 (20%)
uroplakin_I_like_LEL 102..205 CDD:239409 20/109 (18%)
Tsp42EjNP_523636.1 Tetraspannin 11..211 CDD:278750 35/179 (20%)
tetraspanin_LEL 97..183 CDD:239401 20/106 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.