DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp42Ef

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef / 35615 FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster


Alignment Length:247 Identity:61/247 - (24%)
Similarity:104/247 - (42%) Gaps:54/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SLIKYVLFAFNVLFAISGLGILIAGAVVLA---DVNEFNHFVEGRVLAPPIVLIVTGLIIFLIAS 68
            |.:|.:::|.:||..:..| :||:..:.:|   ::||.     |::.|...|.:  |....|:..
  Fly     5 SSVKLIVYALDVLCTLLAL-VLISFGIYVAVSYNLNEI-----GQLTAYGYVGL--GAAALLVVL 61

  Fly    69 LGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRS-NSEDTMA 132
            .|...|.:|:....:||.:.|.::.|.:.||.......:|.:...:.|:|:.:.:.. ||...|:
  Fly    62 WGYLSAWRENVCCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNSPGAMS 126

  Fly   133 WDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGKL 197
            .  .|....|||..||.|:   ..|:.||...|       ...|....|    :.....||    
  Fly   127 L--YQNWFQCCGRGSPQDY---IVNERLPPETC-------FRNHDKSKP----ENLIHTGC---- 171

  Fly   198 KDRIE-KN------------AIILIGVGIGIAFIQILGIVLACYLANSIRQE 236
              |:| :|            |::|||       .::|..|::|.|.||||.:
  Fly   172 --RVEFENYWQHLTKIFNILALVLIG-------FELLLSVISCRLCNSIRND 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 57/240 (24%)
uroplakin_I_like_LEL 102..205 CDD:239409 24/116 (21%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 57/240 (24%)
tetraspanin_LEL 103..181 CDD:239401 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442950
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.