DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp42Ed

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001286152.1 Gene:Tsp42Ed / 35613 FlyBaseID:FBgn0029507 Length:227 Species:Drosophila melanogaster


Alignment Length:248 Identity:69/248 - (27%)
Similarity:126/248 - (50%) Gaps:38/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 CGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFN----HFVEGRVLAPPIVLIVTGLIIF 64
            ||...:|||||.||:||.|.|:.::..|:::::.:.:|:    .|....|   .|:::|.|.::|
  Fly     3 CGGVFVKYVLFIFNILFVICGILLITFGSIMVSTIKDFSGVGETFTANSV---AIIILVLGCVVF 64

  Fly    65 LIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASV----FKKDLEGMVKNSLQESIKRS 125
            |:|.:||.|||:|:...|.:::|::.|:.:.:||:.|...|    .::.||.:|     ::|...
  Fly    65 LVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVDHVQIQQSLEKIV-----QTIWDQ 124

  Fly   126 NSEDTMAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQ 190
            ...|.:..|.:|:...|||::..||:     ..|.|.|||             :||:.|.....|
  Fly   125 RKTDALLMDTLQRSFKCCGLNGFADY-----GITYPASCC-------------DSPSNGTCALTQ 171

  Fly   191 V----GCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQERAK 239
            |    .|:..:....:.|..|:...|:|:..::::..:.||.|||..|..:.:
  Fly   172 VMTRSSCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQTRNSQRR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 66/235 (28%)
uroplakin_I_like_LEL 102..205 CDD:239409 24/110 (22%)
Tsp42EdNP_001286152.1 Tetraspannin 8..217 CDD:278750 65/234 (28%)
tetraspanin_LEL 104..189 CDD:239401 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442940
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.