DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp39D

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_523612.3 Gene:Tsp39D / 35405 FlyBaseID:FBgn0032943 Length:235 Species:Drosophila melanogaster


Alignment Length:239 Identity:84/239 - (35%)
Similarity:137/239 - (57%) Gaps:13/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSCGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLAPPIVLIVTGLIIFL 65
            |.|.|.:.:||:.|..|:|||::||.|.:.|.:|..:...:::||...|...||:|::.|..:.:
  Fly     1 MASGGLTCVKYLTFFCNLLFALTGLLIFLVGGMVQLNYAHYSNFVSDHVWTAPIILMIVGAAVAV 65

  Fly    66 IASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASV----FKKDLEGMVKNSLQESIKRSN 126
            |..|||.||:|||..::::||:|..|||:.|:.:|:|..|    ..:.:|....:::|...:|::
  Fly    66 ICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGLAGYVKHTGLHQIMESQFNSTMQHYKERAD 130

  Fly   127 SEDTMAWDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQV 191
            ..|  ||..:|.:|.|||::.|.||.|:..|.|||.:||....: |....|..:.|.      |.
  Fly   131 YRD--AWTLLQTELDCCGINGPNDWETVYRNSTLPAACCSVINL-SEAKECTNTHAT------QH 186

  Fly   192 GCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQ 235
            ||:.||.:.::...:||..|.:|:|.||:|.|:.||.|..|.|:
  Fly   187 GCLQKLLEILDSKTLILASVVLGVAGIQMLTILFACCLYRSFRR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 79/227 (35%)
uroplakin_I_like_LEL 102..205 CDD:239409 31/106 (29%)
Tsp39DNP_523612.3 Tetraspannin 8..227 CDD:278750 79/227 (35%)
tetraspanin_LEL 104..200 CDD:239401 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D138800at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40247
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
76.950

Return to query results.
Submit another query.