DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp26A

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001097093.1 Gene:Tsp26A / 33838 FlyBaseID:FBgn0031760 Length:314 Species:Drosophila melanogaster


Alignment Length:305 Identity:84/305 - (27%)
Similarity:133/305 - (43%) Gaps:76/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SCGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFN-----HFVEGRVLAPPIVLIVTGLI 62
            ||   .:||:|||.||:..:|.|.:|..|....::...|.     ||:   .|.|..|||:.|.:
  Fly    16 SC---CLKYLLFASNVILWLSALLVLSVGIWAWSEKGMFRNIARLHFI---ALDPAFVLIILGGV 74

  Fly    63 IFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIK---- 123
            .||:..:|..||::|:..||..:|:.|:|:.|.|  :|..|..|....:|.:|:...|.:|    
  Fly    75 TFLLGFMGSVGALRENTCLLGAYAIFLSVLLIAE--IGFCAVAFVLKDKGWIKDQATEGLKAFIR 137

  Fly   124 --RSNSEDTMAWDNIQQK-LMCCGVDSPADWRT----------LSANKT--LPGSCC--QPQYI- 170
              |.:::.....|.||:. |.|||:|.|.||.:          :.:.:.  :|.|||  :||.: 
  Fly   138 HYREDADQQNLIDWIQEDWLQCCGIDGPKDWDSNNYFNCSSIAIGSREACGVPFSCCRRRPQEVI 202

  Fly   171 -DSTVGH-----------------CLE-----------SPALG------------KDKYFQVGCV 194
             :...|:                 ||.           |.|:|            ....::.|||
  Fly   203 KNKQCGYDVRKEGYPVDRNIHERGCLRAGEDWLEAHLISVAIGCVALLVLQGMELSKIIYEKGCV 267

  Fly   195 GKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQERAK 239
            ...::.:|.|.||:....|.:.|.|||||..|..|...|..:::|
  Fly   268 QAGEEWMEHNLIIISATVIVVMFFQILGICFAQNLRADIYTQKSK 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 80/291 (27%)
uroplakin_I_like_LEL 102..205 CDD:239409 34/165 (21%)
Tsp26ANP_001097093.1 Tetraspannin 18..253 CDD:278750 64/239 (27%)
DUF2207 <65..157 CDD:303056 28/93 (30%)
TM4SF9_like_LEL 118..239 CDD:239412 25/120 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442891
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.