DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and cd63

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_955837.1 Gene:cd63 / 321461 ZFINID:ZDB-GENE-030131-180 Length:237 Species:Danio rerio


Alignment Length:234 Identity:86/234 - (36%)
Similarity:135/234 - (57%) Gaps:12/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLAPPIVLIVTGLIIFLIASL 69
            |...:||:||.||.:|.:.||.:::.|  :|..|:..|..:.......|:||||.|:|||.|:..
Zfish     6 GAKCVKYLLFFFNFIFWLCGLALIVLG--ILVHVSLHNTAILQGASGSPMVLIVVGVIIFFISFF 68

  Fly    70 GCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSN--SEDTMA 132
            ||.||.||:..:::|||::|::|.|.|:..|||..:|:..:..::..|....|...|  .|....
Zfish    69 GCCGAWKENQCMVVTFAIILSLIVITEIGAGIAGYIFRGKVNELLDQSFNTMIAGYNKTEEYRTT 133

  Fly   133 WDNIQQKLMCCGVDSPADWRTLSANK-TLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGK 196
            .|:||::|.|||.:|.:||...||:. ::|.|||:....:..:| .:..|.:    .:..||...
Zfish   134 LDSIQKQLKCCGGNSSSDWVNFSADHISVPDSCCKNVTKNCGIG-AMTKPTV----IYLEGCQPI 193

  Fly   197 LKDRIEKNAIILIGVG-IGIAFIQILGIVLACYLANSIR 234
            |:.||::| |:.|.|| :.|.|:||.||||||.|:.:||
Zfish   194 LETRIKEN-ILWIAVGALVIGFVQITGIVLACILSRAIR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 83/227 (37%)
uroplakin_I_like_LEL 102..205 CDD:239409 29/105 (28%)
cd63NP_955837.1 Tetraspannin 9..230 CDD:278750 83/228 (36%)
CD63_LEL 103..202 CDD:239419 29/104 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596266
Domainoid 1 1.000 133 1.000 Domainoid score I5027
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40247
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.740

Return to query results.
Submit another query.