DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp3A

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001245504.1 Gene:Tsp3A / 31244 FlyBaseID:FBgn0040334 Length:304 Species:Drosophila melanogaster


Alignment Length:275 Identity:71/275 - (25%)
Similarity:126/275 - (45%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKYVLFAFNVLFAISGLGILIA--------------GAVVLADVNEFNHFVEGRVLAPPIVLIVT 59
            :||::|..|.:|.:.| |:|:.              |:|.|.  |.::.|     |...:|:|:.
  Fly    43 VKYMIFLLNFVFWLFG-GLLLGIGVYAFRDKWEDANGSVRLE--NFYDVF-----LNISLVMILA 99

  Fly    60 GLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKR 124
            |.:|||::..||.||::|:..||..:::.|.:.|::|:|:.|...|..:.:...::......|..
  Fly   100 GTVIFLVSFSGCVGALRENTFLLKFYSMCLLLFFLLEMAIAIVCFVCPQYMNTFLEKQFTHKIIH 164

  Fly   125 SNSEDTMAW---DNIQQKLMCCGVDSPA--DWRTLSANK------------TLPGSCCQPQYIDS 172
            |..:|....   |..||:..|||:.:..  ||   |.|:            .:|.|||    |::
  Fly   165 SYRDDPDLQNFIDFAQQEFKCCGLSNSGYQDW---SKNEYFNCSSPSVEKCGVPYSCC----INA 222

  Fly   173 T----------VGHCLES---PALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIV 224
            |          .|:.:::   |...| ..:..||:..::...|.|..::.|..:|||.||:|.|.
  Fly   223 TDISSGLVNIMCGYGVQNAPVPEATK-LIWTSGCIEIVRVWAEHNLYVIAGNALGIALIQLLVIY 286

  Fly   225 LACYLANSIRQERAK 239
            ||..|...|..::::
  Fly   287 LAKTLEGQIELQKSR 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 70/267 (26%)
uroplakin_I_like_LEL 102..205 CDD:239409 26/132 (20%)
Tsp3ANP_001245504.1 Tetraspannin 42..295 CDD:278750 70/267 (26%)
penumbra_like_LEL 144..267 CDD:239411 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.