DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tspan6

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001094142.1 Gene:Tspan6 / 302313 RGDID:1560160 Length:245 Species:Rattus norvegicus


Alignment Length:233 Identity:73/233 - (31%)
Similarity:117/233 - (50%) Gaps:22/233 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHF--VEGRVLAPPIVLIVTGLIIFLIASLGCF 72
            |.||..:..:|.|:|:.:|..|  :...|:..|:|  :..:....|.|||.||.:|.|:.:.|||
  Rat    18 KSVLLIYTFIFWITGVILLAVG--IWGKVSLENYFSLLNEKATNVPFVLIGTGTVIILLGTFGCF 80

  Fly    73 GAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSE---DTMAWD 134
            ...:.|..:|..:|:.|.:||:|||...|...||:.:::...|::.:.::|..||.   .:.|.|
  Rat    81 ATCRASAWMLKLYAMFLTLIFLVELVAAIVGFVFRHEIKNSFKSNYENALKEYNSTRDYRSEAVD 145

  Fly   135 NIQQKLMCCGVDSPADWRTLS--ANKTLPGSCCQPQYIDSTVGHCLES--PALGKDKYFQVGCVG 195
            .||..|.||||.:..||:..:  :....|.|||:           ||.  |....||..:.||..
  Rat   146 KIQSTLHCCGVTNYRDWKGTNYYSETGFPKSCCK-----------LEGCYPQRDADKVNEEGCFI 199

  Fly   196 KLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSI 233
            |:...||....::.|:..|:|..|::||.||..|:.:|
  Rat   200 KVMTTIESEMGVVAGISFGVACFQLIGIFLAYCLSRAI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 72/231 (31%)
uroplakin_I_like_LEL 102..205 CDD:239409 31/109 (28%)
Tspan6NP_001094142.1 Tetraspannin 17..233 CDD:395265 71/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20700
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.