DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tspan7

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_062608.2 Gene:Tspan7 / 21912 MGIID:1298407 Length:249 Species:Mus musculus


Alignment Length:233 Identity:66/233 - (28%)
Similarity:117/233 - (50%) Gaps:14/233 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLAPPIVLIVTGLIIFLIASLGCFG 73
            :|.:|..::.:|.|:|:.:|..|......:..:...:.......|.|||.||..|.:....|||.
Mouse    15 LKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIVVFGLFGCFA 79

  Fly    74 AIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSED--TMAWDNI 136
            ..:.||.:|..:|:.|:::|:.||..||:..||:.:::.....:..::::..|..|  :.|.|::
Mouse    80 TCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQNYNGNDERSRAVDHV 144

  Fly   137 QQKLMCCGVDSPADWRT--LSANKTLPGSCCQPQY----IDSTVGHCLESPALGKDKYFQVGCVG 195
            |:.|.||||.:..:|.:  ...:..:|.|||..:.    :|      |.:..:...|..|.||..
Mouse   145 QRSLSCCGVQNYTNWSSSPYFLDHGIPPSCCMNETDCNPLD------LHNLTVAATKVNQKGCYD 203

  Fly   196 KLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSI 233
            .:...:|.|..|:.||..||||.|::|::|||.|:..|
Mouse   204 LVTSFMETNMGIIAGVAFGIAFSQLIGMLLACCLSRFI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 65/231 (28%)
uroplakin_I_like_LEL 102..205 CDD:239409 24/110 (22%)
Tspan7NP_062608.2 Tetraspannin 15..237 CDD:395265 64/227 (28%)
TM4SF2_6_like_LEL 110..213 CDD:239414 24/108 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43294
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.