DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and tsp-7

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_492636.1 Gene:tsp-7 / 192062 WormBaseID:WBGene00006633 Length:232 Species:Caenorhabditis elegans


Alignment Length:234 Identity:74/234 - (31%)
Similarity:124/234 - (52%) Gaps:14/234 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLAPPIVLIVTGLIIFLIASL 69
            |.:::||:||..|::..:.||.::|.|:::....:.....:....||.||:|:|.|.:..|:..|
 Worm     5 GVTIVKYLLFLANLVLWVGGLSLIIVGSILQLKFDNVLDILGDERLATPILLLVIGSLCTLLGFL 69

  Fly    70 GCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIKRSNSEDTM--A 132
            ||.|||:|:..|.::||||||::...|:|..|............:.|.||..:.|.:....:  |
 Worm    70 GCCGAIRENYCLTVSFAVLLALLITCEIAAVIIGYALHDSFRLGIGNQLQTGMVRYHESRGVESA 134

  Fly   133 WDNIQQKLMCCGVDSPADWRTLSANKTLPGSCCQPQYIDSTVGHCLESPALGKDKYFQVGCVGKL 197
            ||...|...||||.:.:||.|.:   |:|.|||    |:...|...|:..|     |:.||:..:
 Worm   135 WDKTHQLFECCGVTNSSDWLTFT---TIPDSCC----IEEIEGCARENAPL-----FEPGCIHSV 187

  Fly   198 KDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIRQE 236
            :..:.||..::.|:...:|.||::|:..||.|:.||.::
 Worm   188 EQWVLKNGAMVGGICAVLAAIQLVGVCFACCLSKSILKD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 71/225 (32%)
uroplakin_I_like_LEL 102..205 CDD:239409 28/104 (27%)
tsp-7NP_492636.1 Tetraspannin 8..223 CDD:278750 71/226 (31%)
NET-5_like_LEL 104..195 CDD:239418 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167498
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29220
OrthoDB 1 1.010 - - D1467737at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14148
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.