DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Cd63

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001036045.1 Gene:Cd63 / 12512 MGIID:99529 Length:238 Species:Mus musculus


Alignment Length:241 Identity:77/241 - (31%)
Similarity:127/241 - (52%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNE--FNHFVEGRVLAPPIVLIVTGLIIFLIA 67
            |...:|::|:...:.|....:|::..|..|...:.:  .:....|.:|  |:|:|..|..:||:|
Mouse     6 GMKCVKFLLYVLLLAFCACAVGLIAIGVAVQVVLKQAITHETTAGSLL--PVVIIAVGAFLFLVA 68

  Fly    68 SLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDLEGMVKNSLQESIK---RSNSED 129
            .:||.||.||:..|:||||:.|::|.:||:||.||..||:..::.....|.|:.::   :.|...
Mouse    69 FVGCCGACKENYCLMITFAIFLSLIMLVEVAVAIAGYVFRDQVKSEFNKSFQQQMQNYLKDNKTA 133

  Fly   130 TMAWDNIQQKLMCCGVDSPADWRTL--SANKTLPGSCCQPQYIDSTVGHCLESPALGKD----KY 188
            |:. |.:|::..|||..:..||..:  .|...:|.|||    |:.||| |      |.|    ..
Mouse   134 TIL-DKLQKENNCCGASNYTDWENIPGMAKDRVPDSCC----INITVG-C------GNDFKESTI 186

  Fly   189 FQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLANSIR 234
            ...|||..:...:.||.:::....:||||:::|||:.:|.|..|||
Mouse   187 HTQGCVETIAIWLRKNILLVAAAALGIAFVEVLGIIFSCCLVKSIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 73/234 (31%)
uroplakin_I_like_LEL 102..205 CDD:239409 30/111 (27%)
Cd63NP_001036045.1 Tetraspannin 10..227 CDD:395265 72/230 (31%)
CD63_LEL 105..203 CDD:239419 29/109 (27%)
Lysosomal targeting motif. /evidence=ECO:0000269|PubMed:21041449 234..238
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850344
Domainoid 1 1.000 128 1.000 Domainoid score I5295
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4578
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43294
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 1 1.000 - - X3621
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.