DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and Tsp68C

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C / 117407 FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster


Alignment Length:275 Identity:60/275 - (21%)
Similarity:118/275 - (42%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRVLA----------PPIV------LIV 58
            |:||...|.||.|.||.::::|..:.:| |:  ..:..|:||          .|::      :.:
  Fly     8 KFVLNLCNFLFLICGLLLVVSGLYIFSD-NK--RILLSRLLAASSDRLSSLPQPLLFYIALGVAI 69

  Fly    59 TGLIIFLIASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKKDL-----EGMVKNSL 118
            .|.:..|.|.:|.:.:...:...|..:.:.:.|:.:.|..:.:|.:::...|     |..:..||
  Fly    70 AGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVRSL 134

  Fly   119 QESIKRSNSED-TMAWDNIQQKLMCCGVDSPAD-----WRTL---SANKTLPGSCC--------- 165
            |.:......|. |.|.|..|.:..|||:.|..|     ||..   ..|..:|.|||         
  Fly   135 QSNYGVPGQEQFTNALDLAQVRFGCCGMRSSLDYDTSLWRLQGYGQRNWPVPLSCCFLKNAGHSM 199

  Fly   166 ---QPQYIDSTVGHCLESPALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQ---ILGIV 224
               .|:..:.::...||..:..::::.: .|:..|.:...:...|.:|..:.:|.|:   :|.|:
  Fly   200 AYLDPKPANESMCQSLERLSYERERHTE-SCLPHLDNWYREQYSIFLGASLILAMIEFCVLLAII 263

  Fly   225 LACYLANSIRQERAK 239
            ::|   ..:..:||:
  Fly   264 MSC---TGLASQRAR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 58/267 (22%)
uroplakin_I_like_LEL 102..205 CDD:239409 28/128 (22%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 58/265 (22%)
tetraspanin_LEL 117..241 CDD:239401 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19282
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.