DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tsp47F and cd151

DIOPT Version :9

Sequence 1:NP_725044.1 Gene:Tsp47F / 36230 FlyBaseID:FBgn0033629 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_031755690.1 Gene:cd151 / 100144686 XenbaseID:XB-GENE-480009 Length:266 Species:Xenopus tropicalis


Alignment Length:265 Identity:79/265 - (29%)
Similarity:126/265 - (47%) Gaps:47/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SCGPSLIKYVLFAFNVLFAISGLGILIAGAVVLADVNEFNHFVEGRV-LAPPIVLIVTGLIIFLI 66
            :||...:||:||.||..|.::||.::..|...|...:::...:.... .|...:|::.|.|:.:.
 Frog    16 TCGTICLKYLLFTFNFFFWLAGLAVMAVGIWTLIQKSDYISLLPSNTYAATAYILVIAGAIVMIT 80

  Fly    67 ASLGCFGAIKESPTLLITFAVLLAVIFIVELAVGIAASVFKK-------DLEGMVKNSLQESI-- 122
            ..|||....||..:||..:.:||..|||:|:..||.|.::.:       .|...:|.||::::  
 Frog    81 GILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQCTPFCLQLNAELKQSLKQTMTT 145

  Fly   123 --KRSNSED-TMAWDNIQQKLMCCGVDSPADWR------TLSANKTL-PGSCCQ----------- 166
              |:...|. |.|.|.:||:..|||.::..|||      :..|.|.| |.|||:           
 Frog   146 KYKQPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSIWINSPEAEKRLVPDSCCKTVTQRCGIRDH 210

  Fly   167 PQYIDSTVGHCLESPALGKDKYFQVGCVGKLKDRIEKNAIILIGVGIGIAFIQILGIVLACYLAN 231
            |..|..|.|                ||:.||:..|..:.:|:..||||||.:|:.|::..|.|..
 Frog   211 PSNIYKTEG----------------GCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYR 259

  Fly   232 SIRQE 236
            |::.|
 Frog   260 SLKSE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tsp47FNP_725044.1 Tetraspannin 9..233 CDD:278750 75/254 (30%)
uroplakin_I_like_LEL 102..205 CDD:239409 34/132 (26%)
cd151XP_031755690.1 Tetraspannin 22..257 CDD:395265 74/250 (30%)
CD151_like_LEL 118..233 CDD:239408 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4418
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.