DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and zgc:152938

DIOPT Version :9

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001070756.1 Gene:zgc:152938 / 768145 ZFINID:ZDB-GENE-061013-458 Length:292 Species:Danio rerio


Alignment Length:161 Identity:43/161 - (26%)
Similarity:76/161 - (47%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ARAISESSTTSD--------NTSDFIEIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVE 63
            |::.:|||:.:.        :....|.:|.....:::.::.|||:::.:..:|.:||::||..|:
Zfish    36 AQSCTESSSETRRKTYWRRMDVEGLISLVSDRRELFDQNHIDYKHIDKREALWQEIAEKIGFHVD 100

  Fly    64 ASKRKWKNLRDSYTKYLRSFR-VGTKTSKKYQYWAHADHMDFLKPFQGPGRNSANGNGKSNDEDD 127
            ..|.|||||||:|.:..|..: .|.:|.||.:.|.....|:||.. ....|...:...:|.||  
Zfish   101 DVKTKWKNLRDTYIRKKREDQCTGEQTPKKKKTWKFMKMMEFLAT-SSEQRRVHSSVKESADE-- 162

  Fly   128 TECDFGYQVLAKAASNGGEDELKITIATASA 158
                         ..:|.|.|..::|:..||
Zfish   163 -------------VGDGSESEKSLSISVESA 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 29/86 (34%)
BESS 478..510 CDD:281011
zgc:152938NP_001070756.1 MADF_DNA_bdg 60..128 CDD:287510 22/67 (33%)
BESS 226..260 CDD:281011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10248
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5004
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.