DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and si:ch211-207i20.3

DIOPT Version :9

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_683419.5 Gene:si:ch211-207i20.3 / 555734 ZFINID:ZDB-GENE-141222-71 Length:263 Species:Danio rerio


Alignment Length:165 Identity:49/165 - (29%)
Similarity:76/165 - (46%) Gaps:38/165 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEASKRKWKNLRDSYTKYLRSFRVGTKT- 89
            :|.:...:::.::.:|||.:.|..:|..|||::|:.||..|.|||||||:||:..|..:.|::: 
Zfish    38 LVSENKELFDKNHSEYKNTKRKEALWQGIADKMGVDVEEVKAKWKNLRDTYTRKKRLEQDGSRSG 102

  Fly    90 --SKKYQYWAHADHMDFLKPFQGPGRNSANGNGKSNDEDDTECDFGYQVLAKAASNGGEDELKIT 152
              :||.:.|.:...||||    .|.....:|...|..||| |.|              ||.    
Zfish   103 RAAKKKKQWKYMRVMDFL----DPATEHRSGILDSKIEDD-EPD--------------EDS---- 144

  Fly   153 IATASAGCSSMGTHTVNTYTTALSSTSASGITSSL 187
                       |....:| :|..|.||...:.||:
Zfish   145 -----------GAEPAST-STGTSVTSPEAMRSSI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 31/84 (37%)
BESS 478..510 CDD:281011
si:ch211-207i20.3XP_683419.5 MADF 35..122 CDD:214738 31/87 (36%)
BESS 199..233 CDD:308542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I10248
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I5004
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.