DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and Dlip3

DIOPT Version :9

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_525003.2 Gene:Dlip3 / 53579 FlyBaseID:FBgn0040465 Length:348 Species:Drosophila melanogaster


Alignment Length:280 Identity:60/280 - (21%)
Similarity:112/280 - (40%) Gaps:82/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KDVKVARAISESSTTSDNTSD-FIEIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEAS 65
            |..|:.|..:|..||.....| .|::|:....:|:..:|.|:...|::.:|.:||:|:|.|....
  Fly    13 KTEKMQRYYAERETTGPEFDDRLIKLVRANPAIYDVSHPHYRRNPVRVDIWDRIANELGASSRFL 77

  Fly    66 KRKWKNLRDSYTKYLRSFRVG--TKTSKKYQYWAHADHMDFLKPFQGPGRNSA------------ 116
            :.||||:|.:|.:.:::...|  ....:|.::   .:.:.||       :|:|            
  Fly    78 QTKWKNIRYNYLQEVKAIETGQANPNVRKRRF---TEDLSFL-------QNTAQTYNVKKSQSYV 132

  Fly   117 ---NGNGKSNDEDD----------TECDFGYQVLAKAASNGGED--------ELKITIATASAGC 160
               ||.|..||.:.          .:...||.::....|:.|.:        ||::.:..:....
  Fly   133 AQQNGMGSDNDSNSFLYPDPEHLKIDASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQL 197

  Fly   161 SSMGTHTVNTYTTALSSTSASGIT-----SSLGATTPPNMISPGSNLGGTGGGSGSVGPQIH--- 217
            |         ..|.|:.||:|..:     :|..|::|  :::|...:|      ...|.::|   
  Fly   198 S---------LPTTLNGTSSSNHSHEHDQASSPASSP--LLTPMVVMG------NGYGQEVHLEQ 245

  Fly   218 -----------NSNSNGSAT 226
                       :|.|||..|
  Fly   246 QQTQEQKPFKNSSLSNGEVT 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 23/88 (26%)
BESS 478..510 CDD:281011
Dlip3NP_525003.2 MADF 34..118 CDD:214738 22/93 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2E5JB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.