DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and CG3919

DIOPT Version :10

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001261840.1 Gene:CG3919 / 39582 FlyBaseID:FBgn0036423 Length:318 Species:Drosophila melanogaster


Alignment Length:111 Identity:29/111 - (26%)
Similarity:55/111 - (49%) Gaps:14/111 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEASKRKWKNLRDSYTKYLRSFRVGTKTS 90
            :||.:..:|:.|:.:|.........|.:|::|:..||::.|.:|:|:|.||.:.:: ...|..| 
  Fly    24 LVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSVKSCKERWRNIRSSYARSIK-LHHGANT- 86

  Fly    91 KKYQYWAHADHMDFLKPFQGP-------GRNSANGNGKSNDEDDTE 129
                |:.::: :.||:....|       ||.|.....:.:||.|.|
  Fly    87 ----YYLNSE-LKFLQKHITPGVPVPLRGRRSRPKGQEEHDEGDPE 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 21/81 (26%)
BESS 478..510 CDD:460758
CG3919NP_001261840.1 MADF 20..100 CDD:214738 21/82 (26%)
BESS 226..260 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.