DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and CG10904

DIOPT Version :10

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_611860.1 Gene:CG10904 / 37817 FlyBaseID:FBgn0034945 Length:266 Species:Drosophila melanogaster


Alignment Length:129 Identity:28/129 - (21%)
Similarity:53/129 - (41%) Gaps:15/129 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TSDNTSDFIEIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEASKRKWKNLRDSYTKYL 80
            |.:..:..||:.:..|.::|:::..|||.:.:.|....|...:.::.....:|..|||:.:...|
  Fly    25 TREKIAKLIELYRSSDCLWNHYSELYKNKDCRAKAIESICASLEITKHDYGKKVHNLRNQFNAEL 89

  Fly    81 RSFR------VGTKTSKKYQYWAHADHMDFLKPF--------QG-PGRNSANGNGKSNDEDDTE 129
            :...      .|.:.|:|...|.|...:.||:..        || ||:...:.......:.|.|
  Fly    90 KKLERRLEESGGDRDSEKACRWEHFKTLMFLRSVIEPRPGYQQGAPGKKLVSKLDMCYPDQDVE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 21/91 (23%)
BESS 478..510 CDD:460758
CG10904NP_611860.1 MADF 31..125 CDD:214738 21/93 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.