DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and hng1

DIOPT Version :10

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_611558.2 Gene:hng1 / 37412 FlyBaseID:FBgn0034599 Length:315 Species:Drosophila melanogaster


Alignment Length:106 Identity:26/106 - (24%)
Similarity:52/106 - (49%) Gaps:11/106 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IEIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEASKRKWKNLRDSYTKYLRSFRVGTK 88
            |:.:::...:|:...|.::..:.|.:.|.::||.:.:|:..::|:|..|||.|::.|:..|:...
  Fly    16 IQTIRETPSLYDPQLPSFRLSQRKEEDWAKVADLLNISISDARRRWTCLRDRYSRELKQKRLHPS 80

  Fly    89 TSKKYQYWAHAD---HMDFLKPFQGPGRNSANGNGKSNDED 126
            ..     :.|.|   .||||:.|.   |......|:..|.:
  Fly    81 GE-----FGHNDFFRKMDFLRDFV---RKRRERRGRERDRE 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 22/86 (26%)
BESS 478..510 CDD:460758
hng1NP_611558.2 MADF 15..98 CDD:214738 22/86 (26%)
BESS 264..298 CDD:460758
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.