DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and madf-2

DIOPT Version :9

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_492896.1 Gene:madf-2 / 173019 WormBaseID:WBGene00009461 Length:290 Species:Caenorhabditis elegans


Alignment Length:231 Identity:41/231 - (17%)
Similarity:85/231 - (36%) Gaps:44/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 TSDNTSDFIEIVKKYDVVYNNH---NPDYKNV------EVKLKVWTQIADEIGLSVEASKRKWKN 71
            |..:....|..::...|:::.:   ..:|:.:      ||..::.:.....|..:.|..:.:|||
 Worm     5 TDPSRQCLINAIRNRPVIWDKNYFGESNYRTLKTSCLREVTSELNSMFQMPIKFTCEDVRSQWKN 69

  Fly    72 LRDSYTKYLRSFRVG--TKTSKKYQYWAHADHMDFLKPFQGPGRNSANGNGKSNDEDDTE----- 129
            |:|::.:.||....|  .:.:.|...|.....:.||                  ||.:.:     
 Worm    70 LKDTFVRKLRWVHEGKYMEDAMKEPTWKFYRMLTFL------------------DEKEAKRLGDT 116

  Fly   130 CDFGYQVLAKAASNGGEDELKITIATASAGCSSMGTHTVNTYTTALSSTSASGITSSLGATTPPN 194
            |:..|::...:.|.|...::.....:.......|..:......:..|...:|.|.:   .:..|.
 Worm   117 CEHTYELAPNSTSCGQRAQISYEPTSTEEKMFQMFNNQPPPQLSQQSMIDSSQIAT---CSNEPK 178

  Fly   195 MISPGSNLGGTGGGSGSVGPQIHNS---NSNGSATG 227
            |.|..:.:    ..|.|:...:|.|   :.|||::|
 Worm   179 MTSSSTFV----TSSTSLKRGVHYSPTRSPNGSSSG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 19/96 (20%)
BESS 478..510 CDD:281011
madf-2NP_492896.1 MADF 11..107 CDD:214738 19/113 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001895
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.