DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and LOC110439798

DIOPT Version :9

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_021332041.1 Gene:LOC110439798 / 110439798 -ID:- Length:273 Species:Danio rerio


Alignment Length:249 Identity:58/249 - (23%)
Similarity:97/249 - (38%) Gaps:49/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SESSTTSDNTSDFIEIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGLSVEASKRKWKNLRDS 75
            |.|:..::.|  .:..|.:..:::|....||::.|.:.:||..:|..|||||...||:||.:||.
Zfish    22 SWSAMAAEET--LLRAVYRIPLLHNRLRTDYRSTERRERVWRDVAASIGLSVVECKRRWKTIRDR 84

  Fly    76 YTKYLRSFRVGTKT-SKKYQYWAHADHMDFLKPFQGPGRNSANGNGKSNDEDDTECDFGYQVLAK 139
            |.:..|..::.... .::..||.|.:.:.||.......|..:...|...::.:..        :.
Zfish    85 YIRERRLCKLKKDLGGRRLHYWPHRESLAFLDAHIRKRRRPSGAQGPEEEQQEEH--------SS 141

  Fly   140 AASNGGEDELKITIATASAGCSSMGTHTVNTYTTALSSTSASGITSSLGATTPPNMISPGSNLGG 204
            ||....::|      .....|.|..:.    :.:.|:....|.:|.    ..|...:||   |..
Zfish   142 AALQEDKEE------CVQEECVSDSSR----FVSPLNPLPLSIVTQ----LKPVPQVSP---LLL 189

  Fly   205 TGGGSGSVGPQIHNSNSNGSATGSLNCAAVAPLSSMTPPATSGSNSAVVLPLPI 258
            |     |:.|.:                .|||.||..||....|.||..|.:|:
Zfish   190 T-----SLPPGL----------------KVAPASSSAPPLLPASASAGPLNVPL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 26/86 (30%)
BESS 478..510 CDD:281011
LOC110439798XP_021332041.1 MADF 32..120 CDD:214738 26/87 (30%)
BESS 233..267 CDD:308542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25292
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.