DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13204 and si:ch73-59f11.3

DIOPT Version :9

Sequence 1:NP_610678.1 Gene:CG13204 / 36227 FlyBaseID:FBgn0033627 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001315046.1 Gene:si:ch73-59f11.3 / 107988036 ZFINID:ZDB-GENE-131121-446 Length:180 Species:Danio rerio


Alignment Length:190 Identity:43/190 - (22%)
Similarity:89/190 - (46%) Gaps:33/190 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EIVKKYDVVYNNHNPDYKNVEVKLKVWTQIADEIGL-SVEASKRKWKNLRDSYTKYLRSF--RVG 86
            |:||.|..:|::...|:|..|.....|.:||.::|: :.|..|..|:|:||.::|.::..  :.|
Zfish    10 ELVKLYPHLYDHSLRDFKVPEKVFNSWKEIATKLGIDNPETCKSTWRNIRDKFSKAMKRMLRKGG 74

  Fly    87 TKTSKKYQYWAHADHMDFLKPFQGPGRNSANGNGKSNDEDDTECDFGYQVL-----------AKA 140
            .:.::..:.:.   .:.:|:||.         ..::|...||.| |.:::.           ..:
Zfish    75 DEDARVPRLFV---ELKWLRPFV---------RLRANTVSDTPC-FEFEIQNEETPKNMVAEESS 126

  Fly   141 ASNGGEDELKITIATASAGCSSMGTHTVNTYTTALSSTSASGITSSLGATTPPNMISPGS 200
            :|:|..:|..:....::|...:.||..::    .||||....:||::...:|.:  :|.|
Zfish   127 SSSGCTNESDVEGRCSAASLDAFGTSALH----RLSSTPCEAVTSTIAQPSPSS--APSS 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13204NP_610678.1 MADF 22..108 CDD:214738 21/85 (25%)
BESS 478..510 CDD:281011
si:ch73-59f11.3NP_001315046.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_119480
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.