DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and PRSS27

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:269 Identity:90/269 - (33%)
Similarity:122/269 - (45%) Gaps:38/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VLVLLLLGDASDVEAT--------GRIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITA 66
            :|:||..|......||        .|::||.|......|||||||.:..|.|||.:.:::.::||
Human     9 LLLLLCFGSQRAKAATACGRPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTA 73

  Fly    67 GHCLHERSVT-LMKVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHY------DIAVLRLSTPLT 124
            .||....|.| |.:|.:||:.....|   |.|.|....|.:|..|:.      |:|::.|..|:.
Human    74 AHCFRNTSETSLYQVLLGARQLVQPG---PHAMYARVRQVESNPLYQGTASSADVALVELEAPVP 135

  Fly   125 FGLSTRAINLASTSPS----GGTTVTVTGWGHTDNGALSDS---LQKAQLQIIDRGEC-----AS 177
            |  :...:.:....||    .|....|||||......|...   |||..:.|||..:|     ..
Human   136 F--TNYILPVCLPDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKD 198

  Fly   178 QKFGYGADFVGEETICAASTDA--DACTGDSGGPLVA----SSQLVGIVSWGYRCADDNYPGVYA 236
            .:|||....:..:.:||...:.  |||.||||||||.    |....|::|||..||..|.||||.
Human   199 TEFGYQPKTIKNDMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYI 263

  Fly   237 DVAILRPWI 245
            .|.....||
Human   264 RVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 82/242 (34%)
Tryp_SPc 28..247 CDD:238113 83/243 (34%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 82/242 (34%)
Tryp_SPc 36..275 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.