DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:257 Identity:84/257 - (32%)
Similarity:123/257 - (47%) Gaps:27/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TVLVLLLLGDASDV---EATGRIIGGSDQLIRNA-PWQVSIQISARHECGGVIYSKEIIITAGHC 69
            |::.|..||.|..:   :...:|:||. ...||| |:|||:. |..|.|||.:.:.:.:::|.||
Mouse     3 TLIFLAFLGAAVALPLDDDDDKIVGGY-TCQRNALPYQVSLN-SGYHFCGGSLINSQWVVSAAHC 65

  Fly    70 LHERSVTLMKVRVGAQNHNY-----GGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLST 129
            ...|    ::||:|  .||.     |...:..|....|..:::...:.||.:::|.|..|.....
Mouse    66 YKSR----IQVRLG--EHNIDALEGGEQFIDAAKIIRHPNYNANTYNNDIMLIKLKTAATLNSRV 124

  Fly   130 RAINLASTSPSGGTTVTVTGWGHT-DNGALSDS-LQKAQLQIIDRGECASQKFGYGADFVGEETI 192
            ..:.|..:.||.||...|:|||:| .:|....| ||.....::....|.|...|.    :.....
Mouse   125 STVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYPGK----ITSNMF 185

  Fly   193 CAASTDA--DACTGDSGGPLVASSQLVGIVSWGYRCADDNYPGVYADVAILRPWIVK--AAN 250
            |....:.  |:|.||||||:|.:.||.|:|||||.||....||||..|.....||.:  |||
Mouse   186 CLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQQTIAAN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 74/227 (33%)
Tryp_SPc 28..247 CDD:238113 76/228 (33%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 74/227 (33%)
Tryp_SPc 25..243 CDD:238113 76/229 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.