DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG17234

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_722785.1 Gene:CG17234 / 59225 FlyBaseID:FBgn0042187 Length:251 Species:Drosophila melanogaster


Alignment Length:255 Identity:98/255 - (38%)
Similarity:128/255 - (50%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLLGDASDVEATG-------RIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCL 70
            ||||  |.|..:.|       |||||....|...|||||:|....|.|||.|||:.||:||.||.
  Fly     7 LLLL--ALDFLSAGQVNRWEQRIIGGEPIGIEQVPWQVSLQYFGDHVCGGSIYSENIIVTAAHCF 69

  Fly    71 HERSVTLM-----KVRVGAQNHNYGGTLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTR 130
            .:.....:     :||.|:...:..||||.|||..:||::.......|||::||||||.|....:
  Fly    70 FDEEGNRLDDQGYQVRAGSALTDSNGTLVDVAALIIHEEYAFDLNINDIAIVRLSTPLEFTSKVQ 134

  Fly   131 AINLASTSPSGGTTVTVTGWGHTDNGALSDS--LQKAQLQIIDRGECASQKFGYGADFVGEETIC 193
            .|.||.|:|...:...|:|||  .:..|:||  |....||    |.....|..:.........:|
  Fly   135 PIPLAKTNPYPRSIALVSGWG--VSYILNDSTNLYPTHLQ----GLALHIKSIFSCRLFDPSLLC 193

  Fly   194 AASTDADACTGDSGGPLVASSQLVGIVSWGYR-CADDNYPGVYADVAILRPWIVKAANAI 252
            |.:....||.||||||||.:.||||:||||.: |....:   :..|...|.||:.|..:|
  Fly   194 AGTYGRTACHGDSGGPLVVNKQLVGVVSWGRKGCVSSAF---FVSVPYFREWILNAIASI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 87/225 (39%)
Tryp_SPc 28..247 CDD:238113 88/226 (39%)
CG17234NP_722785.1 Tryp_SPc 26..243 CDD:214473 87/225 (39%)
Tryp_SPc 27..243 CDD:238113 86/224 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443177
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.