DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG17239

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001259920.1 Gene:CG17239 / 59224 FlyBaseID:FBgn0042186 Length:248 Species:Drosophila melanogaster


Alignment Length:229 Identity:100/229 - (43%)
Similarity:142/229 - (62%) Gaps:10/229 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYGG 91
            ||:||....|.:.|||.||....|..||..|||::|:|||.|||.:|....:.||||:....:||
  Fly    23 RIVGGDLITILSVPWQASILRLGRFHCGAAIYSEDIVITAAHCLTDRETEFLSVRVGSSFTFFGG 87

  Fly    92 TLVPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGW---GHT 153
            .:|.|::..:||::|..:.: ||||:||.:.|..|.:...|.||.|.|:.|:..||:||   |..
  Fly    88 QVVRVSSVLLHEEYDQSWSN-DIAVMRLQSKLRLGSAVSVIPLADTPPASGSPATVSGWGAIGFK 151

  Fly   154 DNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDADACTGDSGGPLVASSQLVG 218
            .|..:  |:..|.:.|:|:.:|   :..||.. :.::.||||:...|||:||||||||:.::|||
  Fly   152 KNYPM--SILSASVDIVDQDQC---RRSYGRK-ITKDMICAAAPGKDACSGDSGGPLVSGNKLVG 210

  Fly   219 IVSWGYRCADDNYPGVYADVAILRPWIVKAANAI 252
            |||:|..||...||||||:||.|:|||:.|...|
  Fly   211 IVSFGKECAHPEYPGVYANVAELKPWILGAIERI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 96/220 (44%)
Tryp_SPc 28..247 CDD:238113 97/221 (44%)
CG17239NP_001259920.1 Tryp_SPc 23..237 CDD:214473 96/220 (44%)
Tryp_SPc 24..237 CDD:238113 95/219 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443180
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.