DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and CG34457

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001097339.1 Gene:CG34457 / 5740661 FlyBaseID:FBgn0085486 Length:308 Species:Drosophila melanogaster


Alignment Length:270 Identity:51/270 - (18%)
Similarity:89/270 - (32%) Gaps:96/270 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYGGTL 93
            :|..|.:  :|.:|.|::|....|              .:||.|..:      |..:.....|.|
  Fly     5 VGDMDSI--SARFQPSVRIGNWVE--------------ENCLEEDKI------VNFKKQRDRGEL 47

  Fly    94 VPVAAYKVHEQFDSRFLHYDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGHTD-NGA 157
            :...|..:::.|     |.:|.:......:.||...:.:.:         .:.::....|| |.|
  Fly    48 LVEKARTLYDNF-----HKEIVLAAPKQTIIFGAIVQLMPI---------HINISDMDTTDLNAA 98

  Fly   158 LS-----DSLQKAQ-------LQII-DRGECASQKF----GYGADFVGE--------ETICAAS- 196
            ||     ..::|:|       |.:. .:..|....|    |.|.|..||        :..|.|| 
  Fly    99 LSVVINEKVVRKSQSINEDCELSVAPSKRPCVRNSFKIVSGDGRDRTGENIKYGQRFQLQCMASE 163

  Fly   197 -------TDADACTGDSGGPLVASSQL----------VGIVSWGYR----CADDNYPGVYADVAI 240
                   :....|....|   |.::.|          :|:|   :|    |.|::.|..|.:   
  Fly   164 HDPIVLYSGPKRCNLQQG---VHATYLSHKNGELNLNLGLV---HRSKLSCPDNDIPIAYTN--- 219

  Fly   241 LRPWIVKAAN 250
               |..:..|
  Fly   220 ---WFCRHVN 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 49/263 (19%)
Tryp_SPc 28..247 CDD:238113 50/265 (19%)
CG34457NP_001097339.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.