DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment iotaTry and AZU1

DIOPT Version :9

Sequence 1:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:268 Identity:63/268 - (23%)
Similarity:96/268 - (35%) Gaps:64/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TVLVLLLLGDASDVEATGR--------IIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIIT 65
            |||.||     :.:.|:.|        |:||.....|..|:..|||...||.|||.:.....::|
Human     5 TVLALL-----AGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMT 64

  Fly    66 AGHCLHERSVTLMKVRVGAQNHNYGGTLVPVAAYKVHEQ-----------------FDSRFLHYD 113
            |..|.              |:.|.|.:.|.:.||.:..:                 :|.:....|
Human    65 AASCF--------------QSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLND 115

  Fly   114 IAVLRL--STPLTFGLSTRAINLASTSPSGGTTVTVTGWG-HTDNGALSDSLQKAQLQIIDRGEC 175
            :.:|:|  ...||..::...:.|.:.:...||...|.||| ....|.||...:...:.:....:|
Human   116 LMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQC 180

  Fly   176 ASQKFGYGADFVGEETICAA--STDADACTGDSGGPLVASSQLVGIVSWGY-RCADDNYPGVYAD 237
            .            ...:|..  :.....|.||.|.|||......|:.|:.. .|.  ..|..:..
Human   181 R------------PNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCG--RGPDFFTR 231

  Fly   238 VAILRPWI 245
            ||:.|.||
Human   232 VALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 55/248 (22%)
Tryp_SPc 28..247 CDD:238113 56/241 (23%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 56/241 (23%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.